Everything below concerns MC4R. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-08-11. Numbers and descriptions here follow the published literature rather than marketing material.
Early research on PT-141 grew out of work on melanotan II, a related cyclic peptide studied for pigmentation. Investigators observed that centrally acting melanocortin agonists also influenced sexual behaviour in animal models, and the programme shifted toward that endpoint. A nasal formulation was evaluated in clinical trials but showed inconsistent absorption, and later studies used subcutaneous administration instead. Regulatory approval in the United States followed in 2019 for a defined population of premenopausal women with acquired, generalised hypoactive sexual desire disorder. That approval was specific to that group rather than a broad indication.
Bremelanotide acts as a non-selective agonist at melanocortin receptors, with reported activity at MC1R, MC3R, MC4R and MC5R. The proposed basis for its central effects is activation of MC4R populations in the hypothalamus, a region associated with appetite and reproductive signalling. Because the peptide carries a net positive charge and polar side chains, it does not cross biological membranes freely, which is one reason oral administration is not the standard route. Effects generally appear within an hour of parenteral administration and are described as centrally mediated rather than peripheral.
Bremelanotide, developed under the code PT-141, is a synthetic cyclic heptapeptide analogue of alpha-melanocyte-stimulating hormone. Its structure is Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH, with a lactam bridge joining the aspartate and lysine side chains. The molecule has the formula C50H68N14O10 and a monoisotopic mass near 1025 daltons. It is commonly prepared as the acetate salt and appears as a white to off-white lyophilised powder in solid form. The free acid is the pharmacologically relevant species, while the counter-ion improves handling and dissolution.
Regulatory status varies by jurisdiction, where approved prescription products, compounded preparations and research-grade material are treated as distinct categories with different documentation requirements. Suppliers of research material commonly issue a certificate of analysis listing purity, identity and sometimes endotoxin content. Independent verification by a third-party laboratory is often recommended because self-reported figures are difficult to check. Literature discussions usually state the source, purity and storage conditions of the material used, since these details affect reproducibility. Analysts note that a reported purity figure does not by itself describe biological activity.
Lyophilised peptide is generally held below minus twenty degrees Celsius, protected from light and moisture, because hydrolysis and oxidation accumulate faster at ambient temperature. Once reconstituted, solutions are typically kept between two and eight degrees Celsius and used within a short window defined by the supplier. Repeated freeze-thaw cycles are avoided since they promote aggregation and loss of soluble material. Container material matters as well, because peptides adsorb to certain plastics and glass surfaces at low concentration. Stability figures supplied by a vendor apply only to the specific lot and buffer that were tested.
Identity and purity are usually established with reversed-phase high-performance liquid chromatography combined with mass spectrometry. A gradient of water and acetonitrile containing trifluoroacetic acid is a common mobile phase, and ultraviolet detection near 214 nanometres responds to the peptide backbone. Mass spectrometry confirms the expected molecular mass and helps reveal truncation or oxidation products. Purity is reported as a peak-area percentage, a figure that depends on the wavelength and gradient used, so values from different laboratories are not always directly comparable. Peptide mapping and amino acid analysis provide additional confirmation when required.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Cyclic heptapeptide | Synthetic analogue of alpha-MSH |
| Molecular formula | C50H68N14O10 | Acetate salt form commonly reported |
| Molecular mass | ~1025 Da | Monoisotopic value near 1025.2 |
| Key structural motif | Lactam bridge | Asp side chain to Lys side chain |
| Solid appearance | White to off-white powder | Lyophilised and hygroscopic |
Reverse-phase high-performance liquid chromatography is the standard method for assessing purity. Mass spectrometry confirms molecular identity and detects sequence variants or truncation products. Ultraviolet absorbance at 214 or 280 nm is used for quantification, with the choice depending on the peptide sequence. Method validation typically addresses linearity, limit of detection, and precision across a defined concentration range. Impurity profiling may also employ ion-exchange or size-exclusion chromatography, and these techniques complement one another.
Certificate of analysis documents usually report purity percentage, molecular weight, and appearance. Researchers verify identity by comparing observed and theoretical mass values. Chain-of-custody records and batch numbers help trace material from source to experiment. Independent verification of supplier claims is considered good practice when material identity is critical to a study. Records should include the storage history of each aliquot, and unexpected deviations in appearance or solubility warrant re-testing before use.
PT-141 is the research code for bremelanotide, a cyclic heptapeptide derived from alpha-melanocyte-stimulating hormone. The molecule belongs to the melanocortin receptor agonist family and shows highest affinity for the MC4 receptor subtype, with weaker activity at MC1, MC3 and MC5. Its structure retains the core His-Phe-Arg-Trp sequence that defines melanocortin recognition, while cyclization and terminal modifications improve metabolic stability relative to the parent hormone. Early work classified the compound as a centrally acting agent rather than a peripherally acting vasodilator, which shaped subsequent development priorities.
Receptor activation in hypothalamic and limbic circuits is the mechanism most often cited for the observed effects on sexual desire. Signalling through MC4R couples to Gs proteins and raises intracellular cyclic AMP, which in turn modulates dopaminergic tone in reward-related pathways. Because the peptide reaches the central nervous system after subcutaneous administration, peripheral vascular changes are regarded as secondary rather than primary. The precise neural circuits that translate receptor occupancy into behavioural change remain incompletely mapped, and published accounts describe the pathway in general terms rather than as a fully resolved sequence.
Activation of MC4R in the hypothalamus is thought to influence dopaminergic signaling, which in turn affects arousal and desire. This mechanism differs from that of phosphodiesterase type 5 inhibitors, which act primarily on vascular smooth muscle in the genital region. Because the pathway is central rather than peripheral, effects are not strictly dependent on local blood flow. The precise downstream cascade linking receptor binding to behavioral outcomes remains an area of ongoing investigation.
Clinical development of bremelanotide proceeded through several reformulation attempts. An early intranasal version was discontinued, and a subcutaneous auto-injector formulation later received approval for hypoactive sexual desire disorder in premenopausal women. Approval decisions have varied by country and over time, and the product has not been universally adopted. Blood pressure elevation is a documented effect, which is why some jurisdictions require monitoring after administration. The clinical evidence base continues to evolve as additional studies are published.
Bremelanotide is a cyclic heptapeptide that acts as an agonist at melanocortin receptors. It binds MC1R, MC3R, MC4R, and MC5R, with MC4R activation considered most relevant to sexual desire pathways in the central nervous system. The molecule is a synthetic analog of alpha-melanocyte-stimulating hormone, a naturally occurring peptide involved in pigmentation and energy regulation. Early research explored its use in tanning before attention shifted toward sexual dysfunction applications. Receptor binding affinity varies across these subtypes.
== External links == "WISP wiki page". "Sensor Systems Lab WISP description". Archived from the original on 2018-10-11. Retrieved 2018-10-11. Alanson P. Sample; Daniel J Yeager; Pauline S Powledge; Alexander V Mamishev; Joshua R Smith (2018-06-06). "Design of an RFID-based battery-free programmable sensing platform". IEEE Transactions on Instrumentation and Measurement. 57 (11): 2608–2615. M. Segev-Bar; N. Bachar; Y.Wolf; B. Ukrainsky; L. Sarraf; H. Haick (Dec 13, 2016). "Multi‐Parametric Sensing Platforms Based on Nanoparticles". Advanced Materials Technologies. 2 (1) 1600206. doi:10.1002/admt.201600206. S2CID 63385571. [...] potentially to differentiate between the different signals. They have advantages in fields that include wearable systems, humanoid robotics, structural health monitoring and precision agriculture, [...]
== As an infection agent == SeV replication occurs exclusively in the cytoplasm of the host cell. The virus is using its own RNA polymerase. One replication cycle takes approximately 12–15 hours with one cell yielding thousands of virions.
There are four major deposit areas in the central Mediterranean: Lipari, Pantelleria, Palmarola and Monte Arci (Sardinia). Ancient sources in the Aegean were Milos and Gyali. Acıgöl town and the Göllü Dağ volcano were the most important sources in central Anatolia, one of the more important source areas in the prehistoric Near East.
Acheson SA, Kirkman HN, Wolfenden R (1988). "Equilibrium of 5,6-hydration of NADH and mechanism of ATP-dependent dehydration". Biochemistry. 27 (19): 7371–5. doi:10.1021/bi00419a030. PMID 3061454. MEINHART JO, CHAYKIN S, KREBS EG (1956). "Enzymatic conversion of a reduced diphosphopyridine nucleotide derivative to reduced diphosphopyridine nucleotide". J. Biol. Chem. 220 (2): 821–9. doi:10.1016/S0021-9258(18)65307-4. PMID 13331940. Regueiro V, Campos MA, Pons J, Alberti S, Bengoechea JA (2006). "The uptake of a Klebsiella pneumoniae capsule polysaccharide mutant triggers an inflammatory response by human airway epithelial cells". Microbiology. 152 (Pt 2): 555–66. doi:10.1099/mic.0.28285-0. PMID 16436443.
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
Sources: en.wikipedia.org
He worked on other methods of analytical separation of biological materials, notably electrophoresis and displacement chromatography, but also was influential in developing biochemical engineering within the Chemical Engineering Department at Yale. He published about 300 papers and held 9 patents. He was a member of the United States National Academy of Engineering. He received many other honors and awards and is remembered in the Horváth Laboratory of Separation Science at Innsbruck.
The mandate includes dose assessment for workers who may be exposed to increased radiation exposure and, if necessary, determination of the activity concentration of residues and radioactive substances discharged with the air or waste water.
==== Edwards v. Aguillard ==== Following the McLean ruling, which declared the teaching of "creation science" in public schools to be an unconstitutional establishment of religion, Louisiana's version of the "Equal Time" legislation was put to the test. This time, Wendell Bird was deputized by the state and ran the state's defense of the law. Dean Kenyon was advertised as the creationists' lead expert witness, however the case (which eventually became Edwards v. Aguillard when it reached the Supreme Court) was decided by summary judgment, and so never went to a full trial. Nevertheless, in written briefs and in his oral arguments, Bird relied heavily on an expert witness affidavit written by Kenyon. This affidavit is online at the TalkOrigins website. It was entered into evidence in the Kitzmiller case as evidence that Kenyon was explicitly defending "creation science"—and advocating that it be given equal time in public schools and textbooks as the "only" alternative to evolution—while at the same time working on a public school textbook, which eventually became the first "intelligent design" book, Of Pandas and People. In 1987, in Edwards v. Aguillard the Supreme Court heard a case concerning a Louisiana Law that required "creation science" be taught on an equal basis with evolution in public schools. Anti-creationists argued that this was illegal on the basis that it violated the Establishment Clause of the US Constitution. Kenyon issued an affidavit in that case, stating his support for creationism, and defining it thus:
=== Memory === Receptor activation is linked to impairing multiple memory processes, including working memory, spatial learning, and fear memory consolidation, by inhibiting synaptic plasticity such as long-term potentiation (LTP) in regions like the amygdala and hippocampus. In models of amnesia, endogenous receptor activation leads to reactivation of memory traces, prolonging retention latency in inhibitory avoidance tasks, with antagonism often protecting against stress-induced deficits. Receptor activation by dynorphins also reduces the intensity of the emotional aspect of memories.
Sources: en.wikipedia.org
There are many benefits to using insects in pet goods, including implications for the environment and sustainability. There is potential for growth in the pet food industry, with many insect species having the ability to be used as a novel protein source. There are also alternate uses for insects, such as control of hypertension and antioxidant properties.
==== Invariant principle ==== According to the Paccaya sutta (SN 12.20) and its parallel, this natural law of this/that conditionality is independent of being discovered by a Buddha (a "Tathāgata"), just like the laws of physics. The Paccaya sutta states that whether or not there are Buddhas who see it "this elemental fact (dhātu, or "principle") just stands (thitā), this basic-pattern-stability (dhamma-tthitatā), this basic-pattern-regularity (dhamma-niyāmatā): specific conditionality (idappaccayatā)." Bhikkhu Sujato translates the basic description of the stability of dependent origination as "the fact that this is real, not unreal, not otherwise". The Chinese parallel at SA 296 similarly states that dependent origination is "the constancy of dharmas, the certainty of dharmas, suchness of dharmas, no departure from the true, no difference from the true, actuality, truth, reality, non-confusion". According to Harvey, these passages indicate that conditionality is "a principle of causal regularity, a Basic Pattern (Dhamma) of things" which can be discovered, understood and then transcended.
==== Catalonia ==== The 2009–2011 Catalan independence referendums, a series of non-binding and unofficial referendums, "popular votes" (consultes populars), took place in municipalities around Catalonia. In them voters indicated whether they supported Catalan independence from Spain. The first such referendum took place in Arenys de Munt on 13 September 2009: there followed votes in Sant Jaume de Frontanyà on 12 December and in 166 other municipalities on 13 December. Another vote ensued in April 2011 in Barcelona. Provisional figures for the 13 December vote suggest a turnout of around 200,000 (30% of those eligible to vote). The 2012 Catalan independence demonstration was a protest march which occurred in central Barcelona in Catalonia, Spain, on 11 September 2012 during the National Day of Catalonia. Many newspapers and other news agencies described it as a "historic" demonstration and considered it to be the biggest protest march ever held in Catalonia since the restoration of democracy in Spain, surpassing other major demonstrations, including the 2010 Catalan autonomy protest. A non-binding Catalan self-determination referendum was held on Sunday, 9 November 2014, to gauge support on the political future of Catalonia. While also referred to as "Catalan independence referendum", the vote was rebranded as a "participation process" by the Government of Catalonia, after a "non-referendum popular consultation" on the same topic and for the same date had been suspended by the Constitutional Court of Spain.
Sources: en.wikipedia.org
PT-141 was the development code used for bremelanotide during its preclinical and early clinical programme. The peptide is now generally referred to by its international nonproprietary name.
The two compounds share the same cyclic core and are both non-selective melanocortin agonists. They differ chiefly at the C-terminus, where bremelanotide carries a free carboxylic acid and melanotan II a terminal amide.
Receptor binding profiles are well characterised in vitro, but the downstream pathway linking MC4R activation to behavioural effects is not fully mapped. Several intermediate neural circuits have been proposed without definitive confirmation.
Purity is normally expressed as a percentage of total peak area from a chromatographic run. The value depends on the column, gradient and detection wavelength chosen. Results generated under different conditions are therefore not always interchangeable.