pharmacokinetics raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-11-13. Anything still debated is marked as such rather than presented as settled.
Bremelanotide is a cyclic heptapeptide that binds several melanocortin receptors rather than one. In vitro assays report agonist activity at MC1R, MC3R, MC4R and MC5R, with MC4R generally treated as the subtype most relevant to sexual effects. MC4R is expressed in hypothalamic nuclei involved in appetite, energy balance and motivated behaviour, which provides a plausible route for central action. Selective MC4R agonists studied in animals produce comparable behavioural changes, supporting that interpretation.
How receptor activation translates into a change in desire is not established in detail. Proposed steps include modulation of dopaminergic signalling in reward circuits and downstream effects on autonomic tone. Human data consist mainly of clinical trials measuring self-reported outcomes rather than direct measurements of brain activity or transmitter release. The transient rise in blood pressure sometimes observed after administration is likewise reported consistently but explained only partly by known melanocortin pathways.
Melanocortin receptors form a family of five G-protein-coupled proteins, labelled MC1R through MC5R, that respond to peptides derived from pro-opiomelanocortin. Alpha-melanocyte-stimulating hormone and adrenocorticotropic hormone are the best-known endogenous ligands. The receptors are distributed differently across tissues, so a single agonist can produce effects in the brain, skin, adrenal gland and vasculature. This distribution explains why one peptide can influence both pigmentation and motivated behaviour.
Reported pharmacodynamic effects include transient rises in blood pressure and heart rate, flushing, nausea and headache, appearing soon after dosing and resolving within hours. These responses were dose-related in early studies and shaped the label's cardiovascular cautions and blood pressure monitoring advice. Gastrointestinal upset is the most frequent reason cited for discontinuation in trials. Whether the vascular signal attenuates with repeated use is not settled. Central effects on desire are described as emerging over weeks rather than immediately, which points to a cumulative rather than acute process.
The compound binds several melanocortin receptor subtypes rather than a single target, with the strongest functional activity reported at MC4R and measurable activity at MC1R, MC3R and MC5R. MC4R populations are dense in hypothalamic nuclei that integrate energy balance, autonomic tone and reproductive behaviour, which is the anatomical basis for the proposed pro-desire effect. Because binding is not subtype-selective, pigmentary and vascular effects accompany central activity. Improving subtype selectivity is an active area of analogue design. Direct causal mapping from receptor occupancy to reported desire change in humans is not fully established.
After subcutaneous dosing, peak plasma concentrations appear within roughly one hour, and elimination is fast, with a half-life on the order of a few hours. Degradation is mainly proteolytic, and at least one circulating fragment retains receptor activity, so parent-drug levels alone do not describe total exposure. Clearance does not depend heavily on hepatic cytochrome enzymes, which lowers the likelihood of common metabolic interaction routes. Data in renal or hepatic impairment are limited. Repeated dosing does not appear to produce marked accumulation given the short half-life.
| Property | Value | Notes |
|---|---|---|
| Primary receptor target | MC4R agonist | Subtype most often linked to behavioural effects |
| Other reported targets | MC1R, MC3R, MC5R | Activity is not selective for a single subtype |
| Endogenous ligand class | Melanocortin peptides | Alpha-MSH and ACTH act on the same family |
| Peptide architecture | Cyclic heptapeptide | Lactam bridge between the aspartate and lysine residues |
| Central action | Inferred from animal models | Not directly measured in the human brain |
Clinical development of bremelanotide proceeded through several reformulation attempts. An early intranasal version was discontinued, and a subcutaneous auto-injector formulation later received approval for hypoactive sexual desire disorder in premenopausal women. Approval decisions have varied by country and over time, and the product has not been universally adopted. Blood pressure elevation is a documented effect, which is why some jurisdictions require monitoring after administration. The clinical evidence base continues to evolve as additional studies are published.
Bremelanotide is a cyclic heptapeptide that acts as an agonist at melanocortin receptors. It binds MC1R, MC3R, MC4R, and MC5R, with MC4R activation considered most relevant to sexual desire pathways in the central nervous system. The molecule is a synthetic analog of alpha-melanocyte-stimulating hormone, a naturally occurring peptide involved in pigmentation and energy regulation. Early research explored its use in tanning before attention shifted toward sexual dysfunction applications. Receptor binding affinity varies across these subtypes.
Development began with intranasal formulations investigated for erectile dysfunction, but blood pressure elevation limited that route and prompted a switch to subcutaneous delivery. Clinical testing then shifted toward hypoactive sexual desire disorder in premenopausal women, and a subcutaneous product received United States approval in 2019. Later trials examined other populations with mixed results, and questions about effect size, durability and patient selection remain open in the peer-reviewed literature. Research interest continues in parallel with the broader melanocortin field, where several synthetic analogues are studied together.
PT-141 is the research code for bremelanotide, a cyclic heptapeptide derived from alpha-melanocyte-stimulating hormone. The molecule belongs to the melanocortin receptor agonist family and shows highest affinity for the MC4 receptor subtype, with weaker activity at MC1, MC3 and MC5. Its structure retains the core His-Phe-Arg-Trp sequence that defines melanocortin recognition, while cyclization and terminal modifications improve metabolic stability relative to the parent hormone. Early work classified the compound as a centrally acting agent rather than a peripherally acting vasodilator, which shaped subsequent development priorities.
Receptor activation in hypothalamic and limbic circuits is the mechanism most often cited for the observed effects on sexual desire. Signalling through MC4R couples to Gs proteins and raises intracellular cyclic AMP, which in turn modulates dopaminergic tone in reward-related pathways. Because the peptide reaches the central nervous system after subcutaneous administration, peripheral vascular changes are regarded as secondary rather than primary. The precise neural circuits that translate receptor occupancy into behavioural change remain incompletely mapped, and published accounts describe the pathway in general terms rather than as a fully resolved sequence.
Certificate of analysis documents usually report purity percentage, molecular weight, and appearance. Researchers verify identity by comparing observed and theoretical mass values. Chain-of-custody records and batch numbers help trace material from source to experiment. Independent verification of supplier claims is considered good practice when material identity is critical to a study. Records should include the storage history of each aliquot, and unexpected deviations in appearance or solubility warrant re-testing before use.
Lyophilized peptide material is generally stored at -20 °C or below to limit degradation, while reconstituted solutions are less stable and are typically kept refrigerated and protected from light. Repeated freeze-thaw cycles can accelerate aggregation and should be minimized. Stability for any specific lot depends on purity, moisture content, and packaging. Handling in a temperature-controlled environment reduces variability across replicates, and exposure to ambient humidity during weighing can introduce error. Aliquotting reduces the number of times a stock container is opened.
Reverse-phase high-performance liquid chromatography is the standard method for assessing purity. Mass spectrometry confirms molecular identity and detects sequence variants or truncation products. Ultraviolet absorbance at 214 or 280 nm is used for quantification, with the choice depending on the peptide sequence. Method validation typically addresses linearity, limit of detection, and precision across a defined concentration range. Impurity profiling may also employ ion-exchange or size-exclusion chromatography, and these techniques complement one another.
The nobelium can then be isolated by exploiting its tendency to form the divalent state, unlike the other trivalent actinides: under typically used elution conditions (bis-(2-ethylhexyl) phosphoric acid (HDEHP) as stationary organic phase and 0.05 M hydrochloric acid as mobile aqueous phase, or using 3 M hydrochloric acid as an eluant from cation-exchange resin columns), nobelium will pass through the column and elute while the other trivalent actinides remain on the column. However, if a direct "catcher" gold foil is used, the process is complicated by the need to separate out the gold using anion-exchange chromatography before isolating the nobelium by elution from chromatographic extraction columns using HDEHP.
== Knudsen cell == The Knudsen cell is used to measure the vapor pressures of a solid with very low vapor pressure. Such a solid forms a vapor at low pressure by sublimation. The vapor slowly effuses through a pinhole, and the loss of mass is proportional to the vapor pressure and can be used to determine this pressure. The heat of sublimation can also be determined by measuring the vapor pressure as a function of temperature, using the Clausius–Clapeyron relation.
Each house consisted of members elected to represent constituencies, plus a few additional members elected by the MPs, and some nominated by the State President. Each house legislated on "own affairs" exclusive to its own race group, and they legislated jointly on "general affairs" affecting all races. In practice, the House of Assembly, which had more MPs than the other two houses combined, continued to dominate the legislature. Each house was chaired by a chairman elected by its members from among themselves. They were coordinated by a Speaker of Parliament, elected by the members of all three houses in a joint sitting. The existing House of Assembly, elected in 1981, was deemed to have been re-elected in 1984, to coordinate its term of office with those of the two new houses. However, this was later overturned by the Supreme Court, and a separate election had to be held for the House of Assembly in 1987. The House elected in 1987 was then dissolved with the other houses in 1989. The black majority were still disfranchised, and the new system lacked legitimacy even among the Coloureds and Asians, many of whom boycotted elections. In a referendum held in 1992, 68.73% of (only white) voters approved the reform process that effectively ended Apartheid. In late 1993, one of the last pieces of legislation passed by the tricameral Parliament was the Interim Constitution, which took effect on 27 April 1994, the same day as the first non-racial elections.
== Diversity == There are a large number of different odor receptors, with as many as 2,000 in the mammalian genome which, depending on the species represents up to 5% of the coding-genes in the genome. However, not all of these potential odor receptor genes are expressed and functional. According to an analysis of data derived from the Human Genome Project, humans have approximately 400 functional genes coding for olfactory receptors, and the remaining 600 candidates are pseudogenes. The reason for the large number of different odor receptors is to provide a system for discriminating between as many different odors as possible. Even so, each odor receptor does not detect a single odor. Rather each individual odor receptor is broadly tuned to be activated by a number of similar odorant structures. Analogous to the immune system, the diversity that exists within the olfactory receptor family allows molecules that have never been encountered before to be characterized. However, unlike the immune system, which generates diversity through in-situ recombination, every single olfactory receptor is translated from a specific gene; hence the large portion of the genome devoted to encoding OR genes. Furthermore, most odors activate more than one type of odor receptor. Since the number of combinations and permutations of olfactory receptors is very large, the olfactory receptor system is capable of detecting and distinguishing between a very large number of odorant molecules.
HN MAPRGESCLLLLTSEIDLPVKRRA S1 MCHWAGGASNTGDARGDVFGKQAG S2 MGVKFFTLSTREFPSVQRAVPLWTNS S3 MLGYNFSSFPCGTISIAPGENFYRLYFIWVNGLAKVVW S4 MLEVMELVNRRGKICRVPETFFNLSL S5 MYCSEVGFCSEVAPTEIFNAGLWV S6 MLDQDIPMVQPLLKVRLEND
Sources: en.wikipedia.org
==== Sovereignty ==== During his tenure as prime minister, Mahathir asserted Malaysia's sovereignty over several features in the Spratly Islands, claiming Swallow Reef in 1983, Ardasier Reef and Mariveles Reef in 1986, and Investigator Shoal and Erica Reef in 1999. His administration cited Malaysia's continental shelf limits and the 1982 UNCLOS as the basis for these claims, while also responding to Vietnam's territorial activities in the region. To strengthen Malaysia's position, Mahathir oversaw the transformation of Swallow Reef into an artificial island with military fortifications, establishing it as a permanent naval outpost. Despite this militarisation, he maintained diplomatic engagement with Beijing, balancing relations with ASEAN claimants and employing a hedging strategy involving China and the United States. Mahathir's foreign policy towards China on the Spratlys was notably pragmatic. While Malaysia pursued its territorial claims, he emphasised dialogue over confrontation. In 1993, he stated that Malaysia had "no problem with China" regarding the Spratlys, and in 1994, he welcomed China's proposal for joint exploration, opposing further internationalisation of the dispute.
== Legality == Plant breeding is subject to a different set of rules and regulations, at times contradictory. The International Union for the Protection of New Varieties of Plants (UPOV Convention) grants limited proprietary rights to breeders over their seeds, under certain conditions. In parallel, and often in a conflicting way, a series of dispositions aiming to fight against biopiracy require breeders to prove that the free, prior and informed consent was obtained from the communities (often Indigenous peoples or peasant communities) from where the seeds used to breed the new variety originates. This is the case in particular of the Nagoya Protocol, a treaty complementing the Convention on Biological Diversity, in force since 2014 (2017 in the European Union). In 2024, the GRATK Treaty was adopted, preventing national patent offices from granting patents based on biopiracy. Patent applicants relying on Cannabis strains will have to disclose the origin of the variety, which often entails compliance under the Nagoya protocol or other similar mechanisms of Access and Benefit Sharing Agreement.
fluorescence in situ hybridization (FISH) A type of in situ hybridization assay where the oligonucleotide probes are labelled with a chemical compound that is naturally fluorescent when exposed to light at particular wavelengths, making it possible to detect the in situ locations of complementary sequences with fluorescence microscopy. FISH is commonly used to visualize the physical locations of specific genes on chromosomes.
Significantly elevated levels of ALT (SGPT) often suggest the existence of other medical problems such as viral hepatitis, diabetes, congestive heart failure, liver damage, bile duct problems, infectious mononucleosis, or myopathy, so ALT is commonly used as a way of screening for liver problems. Elevated ALT may also be caused by dietary choline deficiency. However, elevated levels of ALT do not automatically mean that medical problems exist. Fluctuation of ALT levels is normal over the course of the day, and they can also increase in response to strenuous physical exercise. When elevated ALT levels are found in the blood, the possible underlying causes can be further narrowed down by measuring other enzymes. For example, elevated ALT levels due to hepatocyte damage can be distinguished from bile duct problems by measuring alkaline phosphatase. Also, myopathy-related elevations in ALT should be suspected when the aspartate transaminase (AST) is greater than ALT; the possibility of muscle disease causing elevations in liver tests can be further explored by measuring muscle enzymes, including creatine kinase. Many drugs may elevate ALT levels, including zileuton, omega−3-acid ethyl esters (Lovaza), anti-inflammatory drugs, antibiotics, cholesterol medications, some antipsychotics such as risperidone, and anticonvulsants. Paracetamol (acetaminophen) may also elevate ALT levels. For years, the American Red Cross used ALT testing as part of the battery of tests to ensure the safety of its blood supply by deferring donors with elevated ALT levels.
The renovated park featured a great lawn, as well as hedges and later an iron fence that separated the park from the surrounding city streets. Two entrances each were added from 40th and 42nd Streets. As part of the project, 270 trees were placed around the park. Moses also placed the park's statues along 40th and 42nd Streets so as to block sight lines from these streets. To save money, the project hired workers from the Civil Works Administration, an unemployment relief program. The renovation was complete by late 1934, and after a short postponement, the park reopened that September 15. Parts of the park were closed in the late 1930s due to transit changes on Sixth Avenue; the elevated was torn down in 1938, and the construction of the underground Sixth Avenue subway line occurred around the same time. The Sixth Avenue subway opened in 1940. A New Yorker article remarked in 1936 that during the prior 14 years, "Bryant Park has been closed to the public [...] for half that time."
Sources: en.wikipedia.org
2017, D. A. Belcher, U. Banerjee, C. M. Baehr, K. E. Richardson, P. Cabrales, F. Berthiaume, A. F. Palmer, “Mixtures of tense and relaxed state polymerized human hemoglobin regulate oxygen affinity and tissue construct oxygenation,” PLoS One Oct 11;12(10):e0185988. 2020, L. Diaz-Starokozheva, D. Das, X. Gu, J. T. Moore, L. R. Lemmerman, I. Valerio, H. M. Powell, N. Higuita-Castro, M. R. Go, A. F. Palmer, D. Gallego-Perez, “Early intervention on ischemic tissue with oxygen nanocarriers enables successful implementation of restorative cell therapies,” Cellular and Molecular Bioengineering May 29;13(5):435-446. 2020, D. A. Belcher, A. Lucas, P. Cabrales, A. F. Palmer, “Tumor vascular status controls oxygen delivery facilitated by infused polymerized hemoglobins with varying oxygen affinity,” PLOS Computational Biology Aug 20;16(8):e1008157. Plasma substitutes Palmer's lab demonstrated that human serum albumin (PolyHSA) is able to resuscitate animals from hemorrhagic shock, endotoxemia, sepsis, and ischemia reperfusion injury. Supporting publications:
==== Text message harassment ==== Numerous Black Americans across multiple states reported receiving threatening, racist text messages the day after the election. Some of the texts referenced the incoming Trump administration, but the senders remained unknown as of November 10, 2024. Days later, several Latino and LGBTQIA students also reported receiving similar harassment through text messages and emails.
=== EC 1.20.4 Acting on phosphorus or arsenic in donors, with disulfide as acceptor === EC 1.20.4.1: arsenate reductase (glutaredoxin) EC 1.20.4.2: methylarsonate reductase EC 1.20.4.3: mycoredoxin EC 1.20.4.4: arsenate reductase (thioredoxin)
Histology image: 08601ooa – Histology Learning System at Boston University - "Integument: scalp, transverse" Histology image: 08801ooa – Histology Learning System at Boston University - "Integument: scalp" lesson1 at The Anatomy Lesson by Wesley Norman (Georgetown University) http://www.dartmouth.edu/~humananatomy/figures/chapter_47/47-1.HTM Archived 2016-04-30 at the Wayback Machine
=== Detection in biological fluids === Tramadol and desmetramadol may be quantified in blood, plasma, serum, or saliva to monitor for abuse, confirm a diagnosis of poisoning or assist in the forensic investigation of a sudden death. Most commercial opiate immunoassay screening tests do not cross-react significantly with tramadol or its major metabolites, so chromatographic techniques must be used to detect and quantify these substances. The concentration of desmetramadol in the blood or plasma of a person who has taken tramadol is generally 10–20% that of the parent drug.
Sources: en.wikipedia.org
Bremelanotide binds several melanocortin receptors, and MC4R is the subtype most often cited as responsible for its behavioural effects. Activity at MC1R, MC3R and MC5R is also reported. Selectivity is therefore described as limited rather than precise.
It is not classified as a vasodilator, and its proposed site of action is the central nervous system rather than peripheral vessels. Some trial participants show small transient blood pressure changes. Whether those changes arise centrally or through another route remains an open question.
Most evidence comes from animal models and from indirect human outcomes such as self-reported desire. Direct measurements of receptor occupancy or signalling in the human brain are not available. Published reviews therefore present a plausible pathway rather than a confirmed sequence of events.
MC4R is regarded as the primary mediator on the basis of binding and functional assays. Other subtypes are also engaged, which helps explain flushing and related side effects. The step from receptor activation to reported desire change remains partly inferential.