The short version of Lactam bridge fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-04-08 and is reviewed periodically as new material appears.
Bremelanotide is a synthetic cyclic heptapeptide developed as an analogue of alpha-melanocyte-stimulating hormone, a naturally occurring peptide involved in pigmentation and appetite signalling. Its structure contains seven amino acid residues joined by a lactam bridge that closes the ring between two side chains. The molecular formula is C50H68N14O10 and the nominal molecular mass is near 1025 daltons. Much of the early laboratory literature refers to the same molecule by the development code PT-141.
The compound emerged from a research programme examining melanocortin analogues for effects on skin pigmentation. During early human studies, participants reported spontaneous erections as an unexpected side effect, which redirected development toward sexual function rather than tanning. An intranasal formulation was investigated in clinical trials but did not reach market approval. A subcutaneous injectable version later completed the regulatory process, and the nasal route does not appear in approved labelling.
Approved use is narrow and jurisdiction-specific. In the United States, the injectable product is authorised for premenopausal women with acquired, generalised hypoactive sexual desire disorder, a diagnosis that requires documented distress. It is not approved for men, for postmenopausal women, or for use alongside hormonal contraceptives under the approved labelling. Outside regulated markets, the same peptide is frequently sold as a research chemical, where identity, purity, and sterility are not independently verified.
The peptide contains seven amino acids arranged in a ring, closed by a lactam bridge between a side-chain acid and an amine. This cyclic constraint holds the backbone in a defined conformation and increases resistance to enzymatic breakdown relative to linear analogs. N-terminal acetylation and a C-terminal amide further protect the molecule from exopeptidases. The result is a compound with a comparatively long circulation time for a small peptide. Structural modification of the bridge alters receptor affinity, which is one reason analogs in this family differ in their subtype preferences.
Whether the behavioral effect originates centrally, peripherally, or through both remains an active question. Animal experiments using receptor antagonists and site-specific injections point toward hypothalamic melanocortin circuits as a key locus, but translating those findings to humans is not straightforward. Blood pressure changes observed in trials suggest a vascular component that may be peripherally mediated. The relationship between receptor occupancy and reported effect has not been mapped in humans, and no validated biomarker predicts response. This gap makes it difficult to explain individual variability on pharmacological grounds alone.
Bremelanotide acts as an agonist at melanocortin receptors, a family of five G-protein-coupled receptors labeled MC1 through MC5. Binding studies indicate activity at several of these subtypes rather than strict selectivity for one. Signalling proceeds mainly through Gs-mediated activation of adenylyl cyclase, raising intracellular cyclic AMP. The MC4 receptor, expressed in hypothalamic and limbic circuits, is widely regarded as the subtype most relevant to sexual response. Because the molecule is not subtype-selective, effects at other melanocortin receptors are expected and are used to explain some observed side effects.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C50H68N14O10 | Cyclic heptapeptide backbone |
| Molecular mass | Approximately 1025 Da | Nominal mass of the free peptide |
| Appearance | White to off-white lyophilised powder | Typical for purified synthetic peptides |
| Solubility class | Freely soluble in water | Organic solubility is limited |
| Typical storage temperature | −20 °C or below | Protect from moisture and light |
Compared with melanotan II, bremelanotide is a smaller cyclic peptide with a more constrained backbone, which affects receptor selectivity and metabolic stability. Published descriptions give a plasma half-life on the order of a few hours after subcutaneous administration, with elimination through hepatic and renal routes and limited plasma protein binding. Central access is inferred from effects observed in animal models, although direct measurement in humans is limited. Handling and storage requirements follow from the peptide backbone, which is susceptible to hydrolysis and oxidation.
The melanocortin system comprises five G protein-coupled receptors, designated MC1 through MC5, that signal mainly through cyclic AMP accumulation. MC1R and MC2R are associated with pigmentation and adrenal steroid production, while MC3R and MC4R are expressed in the central nervous system and influence energy balance and behavior. MC5R appears in exocrine tissues. Natural agonists include alpha-melanocyte-stimulating hormone and adrenocorticotropic hormone, and endogenous antagonists such as agouti-related protein modulate the same sites. This receptor family provides the framework within which bremelanotide activity is described.
Bremelanotide acts as an agonist at several melanocortin receptors, with the strongest reported activity at MC4R and measurable activity at MC1R and MC3R. Because MC4R is expressed in hypothalamic and limbic circuits, the proposed mechanism links receptor activation to modulation of central pathways involved in desire rather than to direct effects on peripheral genital tissue. The precise downstream steps remain incompletely characterized, and evidence for the involvement of specific neurotransmitters is suggestive rather than settled. Nausea and blood pressure elevation reported during trials are consistent with melanocortin signaling outside the intended target circuit.
Identity and purity are established with orthogonal methods rather than a single test. Reverse-phase high-performance liquid chromatography with ultraviolet detection gives a purity figure by area normalization, while mass spectrometry confirms the expected molecular ion. Amino acid analysis or peptide mapping can detect sequence errors that a mass value alone would miss, and residual counterion content is sometimes measured separately. Common impurities include truncated sequences, oxidized residues, and deamidated products; reporting them individually is more informative than a single composite purity number.
Lyophilized peptide arrives as a white to off-white cake or powder and is normally held at minus twenty degrees Celsius or colder for extended periods. Short-term bench work at ambient temperature is tolerable for minutes, not hours, because the solid is hygroscopic and picks up moisture that promotes hydrolysis. Vials should stay in a desiccator or a sealed bag with desiccant, protected from light, since aromatic residues in the sequence are susceptible to photo-oxidation. Inventory records that note arrival date and storage location reduce the chance of using degraded material.
== Zirconium-89 == 89Zr is a radioisotope of zirconium with a half-life of 78.36 hours, produced by proton irradiation of natural yttrium (89Y). Its most prominent gamma photon (99% of decays) has an energy of 909 keV and it emits a positron (as opposed to electron capture) about 23% of decays. Zirconium-89 is employed in specialized diagnostic applications using positron emission tomography imaging, for example, with zirconium-89 labeled antibodies (immuno-PET).
==== Covalent ==== With the development of bioconjugation technology, there are plenty of strategies to covalently bind an artificial metallocofactor onto a protein scaffold: cysteine residue based chemistry: Cys-meleimide, Cys-α-haloketone, Cys-benzylhalide chemistry and disulfide formation, post-translational bioorthogonal modification based on Amber stop codon suppression (e.g., Click chemistry) enzyme active site modification (e.g., covalent bond formation between lipase and lipase inhibitor).
Burger King Corporation (also known as BK) is an American fast food chain of hamburger fast food restaurants, headquartered in Miami-Dade County, Florida. The company was founded on July 23, 1953, as Insta-Burger King, a Jacksonville, Florida–based restaurant chain. After Insta-Burger King ran into financial difficulties, its two Miami-based franchisees David Edgerton (1927–2018) and James McLamore (1926–1996) purchased the company in 1959. Over the next half-century, the company changed hands four times and its third set of owners, a partnership between TPG Capital, Bain Capital, and Goldman Sachs Capital Partners, took it public in 2002. In late 2010, 3G Capital of Brazil acquired a majority stake in the company in a deal valued at US$3.26 billion. The new owners promptly initiated a restructuring of the company to reverse its fortunes. 3G, along with its partner Berkshire Hathaway, eventually merged the company with the Canadian-based coffeehouse chain Tim Hortons under the auspices of a new Canadian-based parent company named Restaurant Brands International.
Cells in all organisms regulate gene expression by turnover of gene transcripts (single stranded RNA): The amount of an expressed gene in a cell can be measured by the number of copies of an RNA transcript of that gene present in a sample. In order to robustly detect and quantify gene expression from small amounts of RNA, amplification of the gene transcript is necessary. The polymerase chain reaction (PCR) is a common method for amplifying DNA; for RNA-based PCR the RNA sample is first reverse-transcribed to complementary DNA (cDNA) with reverse transcriptase. In order to amplify small amounts of DNA, the same methodology is used as in conventional PCR using a DNA template, at least one pair of specific primers, deoxyribonucleotide triphosphates, a suitable buffer solution and a thermo-stable DNA polymerase. A substance marked with a fluorophore is added to this mixture in a thermal cycler that contains sensors for measuring the fluorescence of the fluorophore after it has been excited at the required wavelength allowing the generation rate to be measured for one or more specific products. This allows the rate of generation of the amplified product to be measured at each PCR cycle. The data thus generated can be analysed by computer software to calculate relative gene expression (or mRNA copy number) in several samples. Quantitative PCR can also be applied to the detection and quantification of DNA in samples to determine the presence and abundance of a particular DNA sequence in these samples.
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
== Uses == Thorium has been suggested for use in thorium-based nuclear power. In many countries the use of thorium in consumer products is banned or discouraged because it is radioactive. It is currently used in cathodes of vacuum tubes, for a combination of physical stability at high temperature and a low work energy required to remove an electron from its surface. It has, for about a century, been used in mantles of gas and vapor lamps such as gas lights and camping lanterns.
== Role in cancer == Most germline or somatic mutations in the MEN1 gene predict truncation or absence of encoded menin resulting in the inability of MEN1 to act as a tumor suppressor gene. Such mutations in MEN1 have been associated with defective binding of encoded menin to proteins implicated in genetic and epigenetic mechanisms. Menin is a 621 amino acid protein associated with insulinomas which acts as an adapter while also interacting with partner proteins involved in vital cell activities such as transcriptional regulation, cell division, cell proliferation, and genome stability. Insulinomas are neuroendocrine tumors of the pancreas with an incidence of 0.4 % which usually are benign solitary tumors but 5-12 % of cases have distant metastasis at diagnosis. These familial MEN-1 and sporadic tumors may arise either due to loss of heterozygosity or the chromosome region 11q13 where MEN1 is located, or due to presence of mutations in the gene. MEN1 mutations comprise mostly frameshift deletions or insertions, followed by nonsense, missense, splice-site mutations and either part or complete gene deletions resulting in disease pathology. Frameshift and nonsense mutations result in a supposed inactive and truncated menin protein while splice-site mutations result in incorrectly spliced mRNA. Missense mutations of MEN1 are especially important as they result in a change to crucial amino acids needed in order to bind and interact with other proteins and molecules.
== Food and beverage use == S. boulardii is usable in beer brewing, with live yeast remaining in the finished product. It can coexist alongside other S. cerevisiae in mixed starter cultures. It can also be used for baking, where its ability to deter bacteria translates into inhibition of rope spoilage, a bread defect caused by Bacillus subtilis or Bacillus licheniformis contamination.
As of 2018, the overwhelming majority of bitcoin transactions took place on cryptocurrency exchanges. Since 2014, regulated bitcoin funds also allow exposure to the asset or to futures as an investment. Bitcoin is used as a store of value: individuals and companies such as the Winklevoss twins and Elon Musk's companies SpaceX and Tesla have each bought and sold hundreds of millions of dollars worth of bitcoin. Bitcoin wealth is highly concentrated, with 0.01% holding 27% of in-circulation currency, as of 2021. As of March 2025, El Salvador had $550 million worth of bitcoin in its international reserves, about 6,102 coins. Bitcoin, along with other cryptocurrencies, has been described as an economic bubble by several economists, including Nobel Prize in Economics laureates, such as Joseph Stiglitz, James Heckman, and Paul Krugman. Another recipient of the prize, Robert Shiller, argues that bitcoin is rather a fad that may become an asset class. He describes its price growth as an "epidemic", driven by contagious narratives. In 2024, Jean Tirole, also Nobel laureate, described bitcoin as a "pure bubble" as its intrinsic value is zero. According to him, some bubbles are long-lasting such as gold and fiat currencies, and it is impossible to predict whether bitcoin would implode like other financial bubbles or become an alternative to gold. The same year, Federal Reserve Chair Jerome Powell described bitcoin as a digital competitor to gold but not to the dollar as he argued it is a highly volatile speculative asset not used as a form of payment.
Sources: en.wikipedia.org
For services to the Care of the Victims of Torture. Professor Howard Anthony Barnes, Senior Scientist, Unilever Research. For services to Science and Technology. Alison Mary Hore Bastard. For services to the Magistracy in South Devon. Elizabeth Mary Bavidge, Co-Chair, Women's National Commission. For services to Women's Issues. The Very Reverend Trevor Randall Beeson. For services to the Church of England, particularly as Dean of Winchester Cathedral. Hugh Richard Belshaw, lately Finance Director, Oxfam. For Charitable services. Professor Martin Biddle. For services to the Royal Commission on the Historical Monuments of England. Robin Edgar Birley, , Director, Vindolanda Trust. For services to Conservation. Cilla Black. For services to Entertainment. David Blackburn, Senior Management Pay Band 2, the Employment Service, Department for Education and Employment. Peter Kenneth Blair, Managing Director, Racal Research Ltd. For services to the Radar Industry. Victor Harold Blake, Founder Chairman, The London Underwriting Centre (LUC). For services to the Insurance Industry. Charles Conrad Blakey, , Chairman, Kent Probation Committee. For services to the Rehabilitation of Offenders. Ian James Blakey, Director General, British Iron and Steel Producers' Association. For services to Industry. Jennifer Blunt. For services to Medical Research Ethics. Christopher Arthur Booy, Chief Executive, Symonds Group Ltd. For services to the Ministry of Defence. Geoffrey Malcolm Bray, Chairman, Kazakh and Uzbek British Trade and Industry Councils. For services to Export.
=== Forms === Spironolactone is available in the form of tablets (25, 50, and 100 mg; brand name Aldactone, others) and suspensions (25 mg/5 mL; brand name Carospir) for oral administration. It had also been marketed in the form of 2 or 5% topical cream in Italy for the treatment of acne and hirsutism under the brand name Spiroderm, but this product is no longer available. The medication is also available in combination with other medications, such as hydrochlorothiazide (brand name Aldactazide, others). Spironolactone has poor water solubility, so only oral and topical formulations have been developed; other routes of administration such as intravenous injection are not used. The only antimineralocorticoid that is available as a solution for parenteral use is the related medication potassium canrenoate.
The men had been captured in 2022 during fighting in the Donbas and were released in a series of prisoner exchanges. Latvia pledged 2 million euros ($2.15 million) to support the reconstruction of Chernihiv, according to its City Council. The funds were to be used in projects such as buying school equipment and restoring water and sewage systems. The United States Defense Security Cooperation Agency has authorised the sale of a NASAMS system to Ukraine valued at $285 million.
=== Wound dehiscence === The rates of a surgical wound opening after surgery has remained constant. When a wound opens after surgery, the hospital stay becomes longer and the medical care becomes more intensive if a surgical wound opens after surgery.
== History == Balmer Lawrie was founded as a partnership firm on 1 February 1867 in Calcutta, British India, by two Scotsmen: George Stephen Balmer and Alexander Lawrie. It became a private limited company in 1924 with a paid-up share capital of ₹40 lakhs, a public limited company in 1936 and then a Government of India Enterprise in 1972. BL is classified as a category-I Miniratna company.
Sources: en.wikipedia.org
It is a synthetic cyclic peptide that acts as an agonist at melanocortin receptors. It is not a hormone replacement therapy and not a vasodilator in the usual clinical sense, although it does affect vascular tone. Chemically it belongs to the melanocortin analogue family.
PT-141 was the internal development code used during early research and it persists in older publications, conference abstracts, and informal listings. The code and the approved name refer to the same molecule. Its continued use reflects habit in the literature rather than any difference in substance.
No. The intranasal form was studied in trials but was never approved, and absorption through the nasal route varies considerably between individuals. Approved labelling covers a subcutaneous injection only. Any nasal product sold outside regulated channels falls outside verified manufacturing.
It is frequently described as an MC4 receptor agonist, but binding assays show activity at more than one melanocortin subtype. Selectivity is therefore relative rather than absolute. This matters when interpreting side effects tied to other receptor subtypes.