FSFI endpoint is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-04-09. Where a claim depends on a specific study, the study is described rather than over-claimed.
Bremelanotide functions as an agonist at several melanocortin receptor subtypes, with the strongest functional activity reported at the MC4 subtype. MC4 receptors sit in hypothalamic circuits that influence appetite, energy balance, and components of sexual behaviour. Rodents lacking functional MC4 receptors show altered mating behaviour, which supports a role for this pathway in desire. The precise sequence of events connecting receptor activation to reported human effects remains only partly characterised. Because the same receptor family governs pigmentation and inflammatory signalling, selectivity is a recurring theme in pharmacological discussion.
Clinical programmes in this area have relied mainly on randomised, double-blind, placebo-controlled designs in premenopausal women. Primary endpoints usually combine a validated questionnaire covering desire domains with counts of satisfying sexual events and a separate measure of distress. Reported outcomes show statistically significant but modest average improvement over placebo, with wide individual variation. Adverse events such as nausea, flushing, and headache occur frequently and can limit tolerability. Whether short-term trial gains translate into lasting change for most users is an open question.
Evidence outside the studied population is sparse. Trials have concentrated on premenopausal women with a defined diagnosis, and data for postmenopausal women, men, and people taking interacting medications remain limited. Non-prescription use of the peptide for comparable goals is widespread but is not supported by published controlled data. Observed changes in blood pressure have drawn attention to cardiovascular monitoring during use. The literature generally frames the compound as a targeted receptor agonist rather than a general libido enhancer, and basic questions about mechanism and long-term safety are unresolved.
PT-141 is the research designation for bremelanotide, a synthetic cyclic heptapeptide developed as a melanocortin receptor agonist. The peptide contains seven amino acids with an internal lactam bridge that constrains the backbone into a stable ring. Cyclisation of this kind improves resistance to enzymatic degradation relative to linear analogues. The compound was first explored for effects on melanin production, because several melanocortin receptors influence pigmentation. Its later association with sexual desire emerged from observations made during that early work, and the molecule became the subject of a separate development programme.
Bremelanotide is a moderately large peptide with a molecular mass near 1025 daltons. In lyophilised form it appears as a white to off-white powder and is freely soluble in water and other polar solvents. The intact lactam ring is essential for receptor affinity, while linearised fragments bind far more weakly. Solutions are sensitive to extremes of pH and to prolonged exposure to light and heat, so handling typically involves buffered conditions and cold storage. Its short plasma half-life reflects rapid distribution and clearance rather than chemical breakdown inside the vial.
| Property | Value | Notes |
|---|---|---|
| Primary receptor target | MC4 melanocortin receptor | Other melanocortin subtypes are also activated |
| Typical route in approved use | Subcutaneous injection | Single-use format in the marketed product |
| Elimination half-life | Roughly two to three hours | Short exposure supports as-needed use |
| Common adverse events | Nausea, flushing, headache | Generally transient but can be dose limiting |
| Main studied group | Premenopausal women with low desire | Controlled data outside this group are limited |
The melanocortin system comprises five G protein-coupled receptors, designated MC1 through MC5, that signal mainly through cyclic AMP accumulation. MC1R and MC2R are associated with pigmentation and adrenal steroid production, while MC3R and MC4R are expressed in the central nervous system and influence energy balance and behavior. MC5R appears in exocrine tissues. Natural agonists include alpha-melanocyte-stimulating hormone and adrenocorticotropic hormone, and endogenous antagonists such as agouti-related protein modulate the same sites. This receptor family provides the framework within which bremelanotide activity is described.
Bremelanotide acts as an agonist at several melanocortin receptors, with the strongest reported activity at MC4R and measurable activity at MC1R and MC3R. Because MC4R is expressed in hypothalamic and limbic circuits, the proposed mechanism links receptor activation to modulation of central pathways involved in desire rather than to direct effects on peripheral genital tissue. The precise downstream steps remain incompletely characterized, and evidence for the involvement of specific neurotransmitters is suggestive rather than settled. Nausea and blood pressure elevation reported during trials are consistent with melanocortin signaling outside the intended target circuit.
Bremelanotide is a synthetic cyclic heptapeptide developed under the research code PT-141. The code reflects its position in an internal compound series rather than a chemical classification, and the name bremelanotide was later adopted for regulatory filings. Structurally it belongs to the melanocortin peptide family and shares a core sequence motif with alpha-melanocyte-stimulating hormone. The compound is supplied as an acetate salt in aqueous solution for injection. In reference literature it is indexed under both the code and the generic name, a dual listing that can complicate database searches.
Early work on melanocortin analogs in the 1980s and 1990s produced peptides intended to influence pigmentation and appetite. One of these, melanotan II, was observed to affect sexual desire as an incidental finding in self-administration reports. Researchers then pursued analogs with altered receptor selectivity and improved handling characteristics, and PT-141 emerged from that program in the late 1990s. The development path moved from dermatology and metabolism toward a central nervous system application, a shift that shaped both trial designs and the eventual label.
After subcutaneous administration, plasma concentrations rise within roughly thirty minutes and the elimination half-life is short, on the order of two to three hours. Reported physiological responses include transient increases in blood pressure and nausea, which tended to diminish with repeated dosing in trial settings. Because the peptide clears quickly, effects are not expected to persist long after a dose. Absorption from non-injected routes is poorly characterised, and nasal delivery produced variable plasma levels in older work.
Clinical research typically uses randomised, double-blind, placebo-controlled designs. The most common primary endpoint is the desire domain score of the Female Sexual Function Index, sometimes paired with a distress measure. Secondary outcomes include arousal, satisfaction, and event-based counts of satisfying sexual episodes. Across trials, average improvements are modest and individual responses vary widely. Whether benefits persist beyond a few months, and whether they depend on baseline hormone status, remain open questions rather than settled findings.
=== Oath of Allegiance === As with all dominions, provision was made for an Oath of Allegiance. Within dominions, such oaths were taken by parliamentarians personally towards the monarch. The Irish Oath of Allegiance was fundamentally different. It had two elements; the first, an oath to the Free State, as by law established, the second part a promise of fidelity, to His Majesty, King George V, his heirs and successors. That second fidelity element, however, was qualified in two ways. It was to the king in Ireland, not specifically to the king of the United Kingdom. Secondly, it was to the king explicitly in his role as part of the Treaty settlement, not in terms of pre-1922 British rule. The Oath itself came from a combination of three sources, and was largely the work of Michael Collins in the Treaty negotiations. It came in part from a draft oath suggested prior to the negotiations by President de Valera. Other sections were taken by Collins directly from the Oath of the Irish Republican Brotherhood (IRB), of which he was the secret head. In its structure, it was also partially based on the form and structure used for 'Dominion status'.
== History == Experimentally the first examples of mechanically interlocked molecular architectures appeared in the 1960s with catenanes being synthesized by Wasserman and Schill and rotaxanes by Harrison and Harrison. The chemistry of MIMAs came of age when Sauvage pioneered their synthesis using templating methods. In the early 1990s the usefulness and even the existence of MIMAs were challenged. The latter concern was addressed by X ray crystallographer and structural chemist David Williams. Two postdoctoral researchers who took on the challenge of producing [5]catenane (olympiadane) pushed the boundaries of the complexity of MIMAs that could be synthesized their success was confirmed in 1996 by a solid‐state structure analysis conducted by David Williams.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Sources: en.wikipedia.org
== History == Source distantly originates from the GoldSrc engine, itself a heavily modified version of John Carmack's Quake engine with some code from the Quake II engine. Carmack commented on his blog in 2004 that "there are still bits of early Quake code in Half-Life 2". Valve employee Erik Johnson explained the engine's nomenclature on the Valve Developer Community:
==== Food and flavor authentication ==== Foods, flavorings and scents are often sold with the guarantee that chemical additives come from natural sources. This claim becomes hard to test when the chemical compound has a known structure and is readily synthesized in a lab. Authentication of claims about the origins of these chemicals has made good use of various stable isotopes, including those of hydrogen. Combined carbon and hydrogen isotope analysis has been used to test the authenticity of (E)-methyl cinnamate, γ-decalactone and δ-decalactone. Hydrogen and nitrogen isotope ratios have been used for the authentication of alkylpyrazines used as "natural" coffee flavorings.
Throughout the year 2000, ETA committed several attacks against leaders and elected officials of the "constitutionalist" parties that had opposed the "Lizarra Pact" and the PP and the PSOE decided to sign an Antiterrorist Pact, which neither the PNV nor EA joined. This pact, together with the legal encirclement of Batasuna, and the increasing police effectiveness weakened ETA to such an extent that the number of attacks was reduced. However, the confrontation between "nationalists" and "constitutionalists" did not diminish as was evidenced in the Basque elections of May 2001 in which the "nationalist front" triumphed, and the "peneuvist" Juan José Ibarretxe assumed the presidency of the Basque government. As a result of the relative failure of the "constitutionalist front" in the Basque elections of May 2001, the PP government proposed the outlawing of Herri Batasuna ─ at that time integrated in the Euskal Herritarrok coalition ─ for which it agreed with the PSOE and CiU a new Law of Political Parties. Thus, after the attack perpetrated by ETA in Santa Pola in August 2002 ─ which caused the death of two people and which Batasuna did not condemn ─ the process of outlawing began, which was accompanied by the "suspension" of Batasuna's activities by order of Judge Garzón, having found evidence of its connection with ETA. In early 2003, the Supreme Court declared Batasuna illegal as it was considered the "political arm" of ETA.
Sources: en.wikipedia.org
The approved formulation is given by subcutaneous injection and is used on an as-needed basis rather than on a fixed daily schedule. An intranasal version was studied earlier but did not reach the same stage of development. Route of delivery strongly affects how quickly the peptide appears in circulation.
It means the product is taken shortly before anticipated activity instead of every day. This pattern reduces total exposure and shapes how safety monitoring is planned. It also means effects are expected to be temporary rather than cumulative.
Desire is assessed through validated self-report questionnaires, sometimes paired with event counts and a distress scale. These instruments capture subjective experience, so results depend on how participants interpret the questions. No laboratory marker currently substitutes for such reporting.
PT-141 is a laboratory code for bremelanotide, a synthetic peptide that activates melanocortin receptors. It has been developed both as an injectable pharmaceutical product and as a research chemical. The two contexts differ sharply in how identity, purity, and dosing are controlled.