Bremelanotide raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2026-01-12. Anything still debated is marked as such rather than presented as settled.
How receptor activation translates into a change in desire is not established in detail. Proposed steps include modulation of dopaminergic signalling in reward circuits and downstream effects on autonomic tone. Human data consist mainly of clinical trials measuring self-reported outcomes rather than direct measurements of brain activity or transmitter release. The transient rise in blood pressure sometimes observed after administration is likewise reported consistently but explained only partly by known melanocortin pathways.
Melanocortin receptors form a family of five G-protein-coupled proteins, labelled MC1R through MC5R, that respond to peptides derived from pro-opiomelanocortin. Alpha-melanocyte-stimulating hormone and adrenocorticotropic hormone are the best-known endogenous ligands. The receptors are distributed differently across tissues, so a single agonist can produce effects in the brain, skin, adrenal gland and vasculature. This distribution explains why one peptide can influence both pigmentation and motivated behaviour.
Bremelanotide is a cyclic heptapeptide that binds several melanocortin receptors rather than one. In vitro assays report agonist activity at MC1R, MC3R, MC4R and MC5R, with MC4R generally treated as the subtype most relevant to sexual effects. MC4R is expressed in hypothalamic nuclei involved in appetite, energy balance and motivated behaviour, which provides a plausible route for central action. Selective MC4R agonists studied in animals produce comparable behavioural changes, supporting that interpretation.
Regulatory review of bremelanotide concluded in 2019 with approval in the United States for a defined indication in premenopausal women. The reviewed formulation is a single-use prefilled autoinjector given subcutaneously, and its label carries cardiovascular monitoring language tied to blood pressure changes recorded during trials. Availability outside the approving jurisdiction varies, and in several countries the compound remains unapproved or is handled as a prescription-only item. Compounded and research-grade material also circulates, and it differs from the reviewed product in purity, characterization, and chain of custody.
Bremelanotide is a synthetic cyclic heptapeptide developed under the research code PT-141. The code reflects its position in an internal compound series rather than a chemical classification, and the name bremelanotide was later adopted for regulatory filings. Structurally it belongs to the melanocortin peptide family and shares a core sequence motif with alpha-melanocyte-stimulating hormone. The compound is supplied as an acetate salt in aqueous solution for injection. In reference literature it is indexed under both the code and the generic name, a dual listing that can complicate database searches.
| Property | Value | Notes |
|---|---|---|
| Primary receptor target | MC4R agonist | Subtype most often linked to behavioural effects |
| Other reported targets | MC1R, MC3R, MC5R | Activity is not selective for a single subtype |
| Endogenous ligand class | Melanocortin peptides | Alpha-MSH and ACTH act on the same family |
| Peptide architecture | Cyclic heptapeptide | Lactam bridge between the aspartate and lysine residues |
| Central action | Inferred from animal models | Not directly measured in the human brain |
Reported pharmacodynamic effects include transient rises in blood pressure and heart rate, flushing, nausea and headache, appearing soon after dosing and resolving within hours. These responses were dose-related in early studies and shaped the label's cardiovascular cautions and blood pressure monitoring advice. Gastrointestinal upset is the most frequent reason cited for discontinuation in trials. Whether the vascular signal attenuates with repeated use is not settled. Central effects on desire are described as emerging over weeks rather than immediately, which points to a cumulative rather than acute process.
The compound binds several melanocortin receptor subtypes rather than a single target, with the strongest functional activity reported at MC4R and measurable activity at MC1R, MC3R and MC5R. MC4R populations are dense in hypothalamic nuclei that integrate energy balance, autonomic tone and reproductive behaviour, which is the anatomical basis for the proposed pro-desire effect. Because binding is not subtype-selective, pigmentary and vascular effects accompany central activity. Improving subtype selectivity is an active area of analogue design. Direct causal mapping from receptor occupancy to reported desire change in humans is not fully established.
After subcutaneous dosing, peak plasma concentrations appear within roughly one hour, and elimination is fast, with a half-life on the order of a few hours. Degradation is mainly proteolytic, and at least one circulating fragment retains receptor activity, so parent-drug levels alone do not describe total exposure. Clearance does not depend heavily on hepatic cytochrome enzymes, which lowers the likelihood of common metabolic interaction routes. Data in renal or hepatic impairment are limited. Repeated dosing does not appear to produce marked accumulation given the short half-life.
Across literature and commercial listings, the substance appears under several names, including bremelanotide, PT-141, and various brand designations. A CAS registry number provides a unique identifier for the compound, aiding retrieval from chemical databases. Synonym lists may also contain early development codes and descriptive chemical names. When consulting sources, researchers need to confirm that the cited names refer to the same molecular structure to avoid confusion. Naming consistency matters especially when comparing analytical data across publications.
PT-141 is a synthetic cyclic heptapeptide whose development code is bremelanotide. It belongs to the class of melanocortin receptor agonists and acts by mimicking endogenous peptide hormones. The compound originated from research on melanotan II, where investigators exploring derivatives found distinct pharmacological features. Unlike the parent compound, PT-141 showed effects on pathways related to sexual desire and function in early studies, prompting its development as a separate candidate. Its molecular design aimed to separate receptor activity from pigmentary effects.
The molecular backbone consists of seven amino acid residues joined into a ring through a disulfide bridge. This cyclic conformation is critical for receptor binding. The sequence includes an acetylated N-terminus and an amidated C-terminus, modifications that improve resistance to enzymatic breakdown. One residue is in the D-configuration, a feature that further stabilizes the peptide against protease activity. Together, the ring structure and specific stereochemistry determine selectivity among melanocortin receptor subtypes.
BSA is used because of its ability to increase signal in assays, its lack of effect in many biochemical reactions, and its low cost, since large quantities of it can be readily purified from bovine blood, a byproduct of the cattle industry. Another use for BSA is that it can be used to temporarily isolate substances that are blocking the activity of the enzyme that is needed, thus impeding polymerase chain reaction (PCR). BSA has been widely used as a template to synthesize nanostructures and determining the toxic or beneficial effects of metal ions and their complexes. BSA is also the main constituent of fetal bovine serum, a common cell culture medium.
== Diabetes / Insulin Tutorial == There is an abundance of textual / static graphical information about insulin and diabetes on the web. However an AIDA-based Diabetes / Insulin Tutorial has been developed. The tutorial is unusual in that — in addition to offering textual / static graphical information about insulin and diabetes — it is also integrated with the AIDA on-line web-based diabetes simulator. In this way, visitors can not only read about insulin dosage adjustment in diabetes, but also interactively simulate examples of what they are learning about. The tutorial is currently arranged in four sections: (1) Insulin-dosage adjustment, (2) Choosing the insulin dose, (3) Timing of meals & diet planning, and (4) Glucose & the kidney.
=== EC 1.97.1 Sole sub-subclass for oxidoreductases that do not belong in the other subclasses === EC 1.97.1.1: chlorate reductase EC 1.97.1.2: Now EC 5.4.4.9, pyrogallol hydroxytransferase EC 1.97.1.3: Now EC 1.12.98.4, sulfhydrogenase, since hydrogen is known to be the electron donor EC 1.97.1.4: [formate-C-acetyltransferase]-activating enzyme EC 1.97.1.5: Now EC 1.20.4.1, arsenate reductase (glutaredoxin EC 1.97.1.6: Now EC 1.20.99.1, arsenate reductase (donor) EC 1.97.1.7: Now EC 1.20.4.2, methylarsonate reductase EC 1.97.1.8: Now EC 1.21.99.5, tetrachloroethene reductive dehalogenase EC 1.97.1.9: selenate reductase EC 1.97.1.10: Now EC 1.21.99.4 thyroxine 5′-deiodinase EC 1.97.1.11: Now EC 1.21.99.3 thyroxine 5-deiodinase. EC 1.97.1.12: photosystem I
Applied Biosystems is one of various brands under the Life Technologies brand of Thermo Fisher Scientific corporation. The brand is focused on integrated systems for genetic analysis, which include computerized machines and the consumables used within them (such as reagents). In 2008, a merger between Applied Biosystems and Invitrogen was finalized, creating Life Technologies. The latter was acquired by Thermo Fisher Scientific in 2014. Prior to 2008, the Applied Biosystems brand was owned by various entities in a corporate group parented by PerkinElmer. The roots of Applied Biosystems trace back to GeneCo (Genetic Systems Company), a pioneer biotechnology company founded in 1981 in Foster City, California. Through the 1980s and early 1990s, Applied Biosystems, Inc. operated independently and manufactured biochemicals and automated genetic engineering and diagnostic research instruments, including the principal brand of DNA sequencing machine used by the Human Genome Project consortium centers. Applied Biosystems' close ties to the consortium project led to the idea for the founding of Celera Genomics in 1998 as one of several independent competitors to the consortium. In 1993 Applied Biosystems, Inc., was delisted from the NASDAQ when it was acquired by the old company known then as Perkin-Elmer. As the PE Applied Biosystems Division under that parent in 1998, it became consolidated with other acquisitions as the primary PE Biosystems Division.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
Sources: en.wikipedia.org
immunostaining The use of an antibody conjugated to a chromophore or fluorophore to bind a specific antigen within a target substance (e.g. a protein) and thereby make the substance visible amidst a background of non-specific substances, allowing for detection of the target in a biological sample. The term originally referred to antibody-based staining of tissue sections with strong dyes or colorants, known as immunohistochemistry, but in modern usage encompasses a much broader range of laboratory methods united by their use of antibodies to label specific biomolecules with visually conspicuous compounds.
=== Historical perspective === To date, over 20 different secondary structure prediction methods have been developed. One of the first algorithms was Chou–Fasman method, which relies predominantly on probability parameters determined from relative frequencies of each amino acid's appearance in each type of secondary structure. The original Chou-Fasman parameters, determined from the small sample of structures solved in the mid-1970s, produce poor results compared to modern methods, though the parameterization has been updated since it was first published. The Chou-Fasman method is roughly 50–60% accurate in predicting secondary structures. The next notable program was the GOR method is an information theory-based method. It uses the more powerful probabilistic technique of Bayesian inference. The GOR method takes into account not only the probability of each amino acid having a particular secondary structure, but also the conditional probability of the amino acid assuming each structure given the contributions of its neighbors (it does not assume that the neighbors have that same structure). The approach is both more sensitive and more accurate than that of Chou and Fasman because amino acid structural propensities are only strong for a small number of amino acids such as proline and glycine. Weak contributions from each of many neighbors can add up to strong effects overall. The original GOR method was roughly 65% accurate and is dramatically more successful in predicting alpha helices than beta sheets, which it frequently mispredicted as loops or disorganized regions.
is constant), the relation Qp = Q1p1 = Q2p2 can be obtained. Over a short section of the pipe, the gas flowing through the pipe can be assumed to be incompressible so that Poiseuille law can be used locally,
They had planned to wed in summer 2020 but postponed the event twice due to the COVID-19 pandemic. At her wedding, Alizée wore the 1980s wedding dress belonging to Carole Middleton, her mother-in-law. The couple welcomed their first child, Inigo Gabriel, on 21 September 2023.
dyspepsia of a non-ulcer/dysmotility type (gastric "fullness", discomfort, and possible pain) gastroparesis (delayed gastric emptying) anorexia heartburn regurgitation bloating nausea and vomiting other possible gastric, prolactin, or dopamine related conditions Itopride was shown to significantly improve symptoms in patients with functional dyspepsia and motility disorders in placebo-controlled trials. These studies concluded that the reduction in the severity of symptoms of functional dyspepsia after 8 weeks of treatment with itopride indicated that itopride was significantly superior to placebo and that itopride yielded a greater rate of response than placebo in significantly reducing pain and fullness.
Sources: en.wikipedia.org
Bremelanotide binds several melanocortin receptors, and MC4R is the subtype most often cited as responsible for its behavioural effects. Activity at MC1R, MC3R and MC5R is also reported. Selectivity is therefore described as limited rather than precise.
It is not classified as a vasodilator, and its proposed site of action is the central nervous system rather than peripheral vessels. Some trial participants show small transient blood pressure changes. Whether those changes arise centrally or through another route remains an open question.
Most evidence comes from animal models and from indirect human outcomes such as self-reported desire. Direct measurements of receptor occupancy or signalling in the human brain are not available. Published reviews therefore present a plausible pathway rather than a confirmed sequence of events.
PT-141 was the internal development code assigned to bremelanotide during preclinical research. Reference sources sometimes index the peptide under the code rather than the generic name. The two terms describe the same molecule.